ࡱ> 8hijkghijklmnopqrsZ  !"#$%&'()*+,-./01234567G:;<=>?@ABCDYFHIJMNOPQRSTUVWX\_[a]^b`KEcdefgmnopqrstuvwxyz{|}~Root Entry( F~93SummaryInformation(7@H?CAED1H(@H?dA/B6H 4@H?;C8DE # @H??wElDj>D/HG@H??wElDj;E$H @HBExE(H &gNameTableTypeColumn_ValidationIdentifierNString categoryText;Formatted;Template;Condition;Guid;Path;Version;Language;Identifier;Binary;UpperCase;LowerCase;Filename;Paths;AnyPath;WildCardFilename;RegPath;KeyFormatted;CustomSource;Property;Cabinet;Shortcut;URLYDescriptionSetCategoryKeyColumnKeyTableMaxValueMinValueNullableName of columnTextDescription of columnColumn to which foreign key connectsFor foreign key, Name of table to which data must linkMaximum value allowedMinimum value allowedY;N;@Whether the column is nullableSet of values that are permittedName of tableActionTextActionName of action to be described.Localized description displayed in progress dialog and log when action is executing.TemplateOptional localized format template used to format action data records for display during action execution.AdminExecuteSequenceName of action to invoke, either in the engine or the handler DLL.ConditionOptional expression which skips the action if evaluates to expFalse.If the expression syntax is invalid, the engine will terminate, returning iesBadActionData.SequenceNumber that determines the sort order in which the actions are to be executed. Leave blank to suppress action.AdminUISequenceAdvtExecuteSequenceAdvtUISequenceAppIdActivateAtStorageGuidDllSurrogateLocalServiceRemoteServerNameFormattedRunAsInteractiveUserServiceParametersAppSearchPropertyThe property associated with a SignatureSignature_Signature;RegLocator;IniLocator;DrLocator;CompLocatorThe Signature_ represents a unique file signature and is also the foreign key in the Signature, RegLocator, IniLocator, CompLocator and the DrLocator tables.BBControlAttributesA 32-bit word that specifies the attribute flags to be applied to this control.Name of the control. This name must be unique within a billboard, but can repeat on different billboard.Billboard_BillboardExternal key to the Billboard table, name of the billboard.HeightHeight of the bounding rectangle of the control.A string used to set the initial text contained within a control (if appropriate).The type of the control.WidthWidth of the bounding rectangle of the control.XHorizontal coordinate of the upper left corner of the bounding rectangle of the control.Vertical coordinate of the upper left corner of the bounding rectangle of the control.The name of an action. The billboard is displayed during the progress messages received from this action.Name of the billboard.Feature_FeatureAn external key to the Feature Table. The billboard is shown only if this feature is being installed.OrderingA positive integer. If there is more than one billboard corresponding to an action they will be shown in the order defined by this column.BinaryDataThe unformatted binary data.Unique key identifying the binary data.BindImageFile_FileThe index into the File table. This must be an executable file.PathPathsA list of ; delimited paths that represent the paths to be searched for the import DLLS. The list is usually a list of properties each enclosed within square brackets [] .CCPSearchCheckBoxA named property to be tied to the item.ValueThe value string associated with the item.ClassAppId_Optional AppID containing DCOM information for associated application (string GUID).Argumentoptional argument for LocalServers.Class registration attributes.CLSIDThe CLSID of an OLE factory.Component_ComponentRequired foreign key into the Component Table, specifying the component for which to return a path when called through LocateComponent.ContextThe numeric server context for this server. CLSCTX_xxxxDefInprocHandlerFilename1;2;3Optional default inproc handler. Only optionally provided if Context=CLSCTX_LOCAL_SERVER. Typically "ole32.dll" or "mapi32.dll"Localized description for the Class.Required foreign key into the Feature Table, specifying the feature to validate or install in order for the CLSID factory to be operational.FileTypeMaskOptional string containing information for the HKCRthis CLSID) key. If multiple patterns exist, they must be delimited by a semicolon, and numeric subkeys will be generated: 0,1,2...Icon_IconOptional foreign key into the Icon Table, specifying the icon file associated with this CLSID. Will be written under the DefaultIcon key.IconIndexOptional icon index.ProgId_DefaultProgIdOptional ProgId associated with this CLSID.ComboBoxOrderA positive integer used to determine the ordering of the items within one list. The integers do not have to be consecutive.A named property to be tied to this item. All the items tied to the same property become part of the same combobox.The visible text to be assigned to the item. Optional. If this entry or the entire column is missing, the text is the same as the value.The value string associated with this item. Selecting the line will set the associated property to this value.CompLocatorComponentIdA string GUID unique to this component, version, and language.The table key. The Signature_ represents a unique file signature and is also the foreign key in the Signature table.A boolean value that determines if the registry value is a filename or a directory location.ComplusForeign key referencing Component that controls the ComPlus component.ExpTypeComPlus component attributes.Remote execution option, one of irsEnumPrimary key used to identify a particular component record.A conditional statement that will disable this component if the specified condition evaluates to the 'True' state. If a component is disabled, it will not be installed, regardless of the 'Action' state associated with the component.Directory_DirectoryRequired key of a Directory table record. This is actually a property name whose value contains the actual path, set either by the AppSearch action or with the default setting obtained from the Directory table.KeyPathFile;Registry;ODBCDataSourceEither the primary key into the File table, Registry table, or ODBCDataSource table. This extract path is stored when the component is installed, and is used to detect the presence of the component and to return the path to it.Expression evaluated to determine if Level in the Feature table is to change.Reference to a Feature entry in Feature table.LevelNew selection Level to set in Feature table if Condition evaluates to TRUE.ControlName of the control. This name must be unique within a dialog, but can repeat on different dialogs. Control_NextThe name of an other control on the same dialog. This link defines the tab order of the controls. The links have to form one or more cycles!Dialog_DialogExternal key to the Dialog table, name of the dialog.HelpThe help strings used with the button. The text is optional. The name of a defined property to be linked to this control. ControlConditionDefault;Disable;Enable;Hide;ShowThe desired action to be taken on the specified control.A standard conditional statement that specifies under which conditions the action should be triggered.Control_A foreign key to the Control table, name of the control.A foreign key to the Dialog table, name of the dialog.ControlEventA value to be used as a modifier when triggering a particular event.A standard conditional statement that specifies under which conditions an event should be triggered.A foreign key to the Control table, name of the controlEventAn identifier that specifies the type of the event that should take place when the user interacts with control specified by the first two entries.An integer used to order several events tied to the same control. Can be left blank.CreateFolderForeign key into the Component table.Primary key, could be foreign key into the Directory table.CustomActionPrimary key, name of action, normally appears in sequence table unless private use.SourceCustomSourceThe table reference of the source of the code.TargetExcecution parameter, depends on the type of custom actionThe numeric custom action type, consisting of source location, code type, entry, option flags.A 32-bit word that specifies the attribute flags to be applied to this dialog.Control_CancelDefines the cancel control. Hitting escape or clicking on the close icon on the dialog is equivalent to pushing this button.Control_DefaultDefines the default control. Hitting return is equivalent to pushing this button.Control_FirstDefines the control that has the focus when the dialog is created.Name of the dialog.HCenteringHorizontal position of the dialog on a 0-100 scale. 0 means left end, 100 means right end of the screen, 50 center.Height of the bounding rectangle of the dialog.TitleA text string specifying the title to be displayed in the title bar of the dialog's window.VCenteringVertical position of the dialog on a 0-100 scale. 0 means top end, 100 means bottom end of the screen, 50 center.Width of the bounding rectangle of the dialog.DefaultDirThe default sub-path under parent's path.Unique identifier for directory entry, primary key. If a property by this name is defined, it contains the full path to the directory.Directory_ParentReference to the entry in this table specifying the default parent directory. A record parented to itself or with a Null parent represents a root of the install tree.DrLocatorDepthThe depth below the path to which the Signature_ is recursively searched. If absent, the depth is assumed to be 0.ParentThe parent file signature. It is also a foreign key in the Signature table. If null and the Path column does not expand to a full path, then all the fixed drives of the user system are searched using the Path.AnyPathThe path on the user system. This is a either a subpath below the value of the Parent or a full path. The path may contain properties enclosed within [ ] that will be expanded.The Signature_ represents a unique file signature and is also the foreign key in the Signature table.DuplicateFileForeign key referencing Component that controls the duplicate file.DestFolderName of a property whose value is assumed to resolve to the full pathname to a destination folder.DestNameFilename to be given to the duplicate file.Foreign key referencing the source file to be duplicated.FileKeyPrimary key used to identify a particular file entryEnvironmentForeign key into the Component table referencing component that controls the installing of the environmental value.Unique identifier for the environmental variable settingThe name of the environmental value.The value to set in the environmental settings.ErrorInteger error number, obtained from header file IError(...) macros.MessageError formatting template, obtained from user ed. or localizers.EventMappingAttributeThe name of the control attribute, that is set when this event is received.A foreign key to the Dialog table, name of the Dialog.An identifier that specifies the type of the event that the control subscribes to.ExtensionThe extension associated with the table row.MIME_MIMEOptional Context identifier, typically "type/format" associated with the extensionProgId_Optional ProgId associated with this extension.0;1;2;4;5;6;8;9;10;16;17;18;20;21;22;24;25;26;32;33;34;36;37;38;48;49;50;52;53;54Feature attributesLonger descriptive text describing a visible feature item.UpperCaseThe name of the Directory that can be configured by the UI. A non-null value will enable the browse button.DisplayNumeric sort order, used to force a specific display ordering.Primary key used to identify a particular feature record.Feature_ParentOptional key of a parent record in the same table. If the parent is not selected, then the record will not be installed. Null indicates a root item.The install level at which record will be initially selected. An install level of 0 will disable an item and prevent its display.Short text identifying a visible feature item.FeatureComponentsForeign key into Component table.Foreign key into Feature table.Integer containing bit flags representing file attributes (with the decimal value of each bit position in parentheses)Foreign key referencing Component that controls the file.Primary key, non-localized token, must match identifier in cabinet. For uncompressed files, this field is ignored.FileNameFile name used for installation, may be localized. This may contain a "short name|long name" pair.FileSizeSize of file in bytes (long integer).LanguageList of decimal language Ids, comma-separated if more than one.Sequence with respect to the media images; order must track cabinet order.VersionVersion string for versioned files; Blank for unversioned files.FileSFPCatalogFile associated with the catalogSFPCatalog_SFPCatalogCatalog associated with the fileFontPrimary key, foreign key into File table referencing font file.FontTitleFont name.Binary stream. The binary icon data in PE (.DLL or .EXE) or icon (.ICO) format.Primary key. Name of the icon file.IniFile0;1;3The type of modification to be made, one of iifEnumForeign key into the Component table referencing component that controls the installing of the .INI value.DirPropertyForeign key into the Directory table denoting the directory where the .INI file is.The .INI file name in which to write the informationPrimary key, non-localized token.KeyThe .INI file key below Section.SectionThe .INI file Section.The value to be written.IniLocatorFieldThe field in the .INI line. If Field is null or 0 the entire line is read.The .INI file name.Key value (followed by an equals sign in INI file).Section name within in file (within square brackets in INI file).An integer value that determines if the .INI value read is a filename or a directory location or to be used as is w/o interpretation.InstallExecuteSequenceInstallUISequenceIsolatedComponentComponent_ApplicationKey to Component table item for applicationComponent_SharedKey to Component table item to be isolatedLaunchConditionExpression which must evaluate to TRUE in order for install to commence.Localizable text to display when condition fails and install must abort.ListBoxA positive integer used to determine the ordering of the items within one list..The integers do not have to be consecutive.A named property to be tied to this item. All the items tied to the same property become part of the same listbox.ListViewBinary_The name of the icon to be displayed with the icon. The binary information is looked up from the Binary Table.A named property to be tied to this item. All the items tied to the same property become part of the same listview.LockPermissionsDomainDomain name for user whose permissions are being set. (usually a property)LockObjectForeign key into Registry or File tablePermissionPermission Access mask. Full Control = 268435456 (GENERIC_ALL = 0x10000000)Directory;File;RegistryReference to another table nameUserUser for permissions to be set. (usually a property)MediaCabinetIf some or all of the files stored on the media are compressed in a cabinet, the name of that cabinet.DiskIdPrimary key, integer to determine sort order for table.DiskPromptDisk name: the visible text actually printed on the disk. This will be used to prompt the user when this disk needs to be inserted.LastSequenceFile sequence number for the last file for this media.The property defining the location of the cabinet file.VolumeLabelThe label attributed to the volume.Optional associated CLSID.ContentTypePrimary key. Context identifier, typically "type/format".Extension_Optional associated extension (without dot)ModuleComponentsComponent contained in the module.ModuleSignatureDefault language ID for module (may be changed by transform).ModuleIDModule containing the component.ModuleDependencyModule requiring the dependency.ModuleLanguageLanguage of module requiring the dependency.RequiredIDString.GUID of required module.RequiredLanguageLanguageID of the required module.RequiredVersionVersion of the required version.ModuleExclusionExcludedIDString.GUID of excluded module.ExcludedLanguageLanguage of excluded module.ExcludedMaxVersionMaximum version of excluded module.ExcludedMinVersionMinimum version of excluded module.String.GUID of module with exclusion requirement.LanguageID of module with exclusion requirement.Default decimal language of module.Module identifier (String.GUID).Version of the module.MoveFileIf this component is not "selected" for installation or removal, no action will be taken on the associated MoveFile entryName of a property whose value is assumed to resolve to the full path to the destination directoryName to be given to the original file after it is moved or copied. If blank, the destination file will be given the same name as the source filePrimary key that uniquely identifies a particular MoveFile recordOptionsInteger value specifying the MoveFile operating mode, one of imfoEnumSourceFolderName of a property whose value is assumed to resolve to the full path to the source directorySourceNameName of the source file(s) to be moved or copied. Can contain the '*' or '?' wildcards.MsiAssemblyAssembly attributesFile_ApplicationForeign key into File table, denoting the application context for private assemblies. Null for global assemblies.File_ManifestForeign key into the File table denoting the manifest file for the assembly.MsiAssemblyNameThe name part of the name-value pairs for the assembly name.The value part of the name-value pairs for the assembly name.MsiDigitalCertificateCertDataA certificate context blob for a signer certificateDigitalCertificateA unique identifier for the rowMsiDigitalSignatureDigitalCertificate_Foreign key to MsiDigitalCertificate table identifying the signer certificateHashThe encoded hash blob from the digital signatureSignObjectForeign key to Media tableReference to another table name (only Media table is supported)MsiFileHashPrimary key, foreign key into File table referencing file with this hashVarious options and attributes for this hash.HashPart1HashPart2HashPart3HashPart4MsiPatchHeadersStreamRefPrimary key. A unique identifier for the row.HeaderBinary stream. The patch header, used for patch validation.ODBCAttributeName of ODBC driver attributeDriver_ODBCDriverReference to ODBC driver in ODBCDriver tableValue for ODBC driver attributeODBCDataSourceReference to associated componentDataSourcePrimary key, non-localized.internal token for data sourceText used as registered name for data sourceDriverDescriptionReference to driver description, may be existing driverRegistrationRegistration option: 0=machine, 1=user, others t.b.d.Text used as registered name for driver, non-localizedDriverPrimary key, non-localized.internal token for driverReference to key driver fileFile_SetupOptional reference to key driver setup DLLODBCSourceAttributeName of ODBC data source attributeDataSource_Reference to ODBC data source in ODBCDataSource tableValue for ODBC data source attributeODBCTranslatorText used as registered name for translatorReference to key translator fileOptional reference to key translator setup DLLTranslatorPrimary key, non-localized.internal token for translatorPatchInteger containing bit flags representing patch attributesPrimary key, non-localized token, foreign key to File table, must match identifier in cabinet.PatchSizeSize of patch in bytes (long integer).Primary key, sequence with respect to the media images; order must track cabinet order.StreamRef_Identifier. Foreign key to the StreamRef column of the MsiPatchHeaders table.PatchPackageMedia_Foreign key to DiskId column of Media table. Indicates the disk containing the patch package.PatchIdA unique string GUID representing this patch.Class_The CLSID of an OLE factory corresponding to the ProgId.Localized description for the Program identifier.Optional foreign key into the Icon Table, specifying the icon file associated with this ProgId. Will be written under the DefaultIcon key.The Program Identifier. Primary key.ProgId_ParentThe Parent Program Identifier. If specified, the ProgId column becomes a version independent prog id.Name of property, uppercase if settable by launcher or loader.String value for property. Never null or empty.PublishComponentAppDataThis is localisable Application specific data that can be associated with a Qualified Component.A string GUID that represents the component id that will be requested by the alien product.Foreign key into the Feature table.QualifierThis is defined only when the ComponentId column is an Qualified Component Id. This is the Qualifier for ProvideComponentIndirect.RadioButtonThe height of the button.The help strings used with the button. The text is optional.A named property to be tied to this radio button. All the buttons tied to the same property become part of the same group.The visible title to be assigned to the radio button.The value string associated with this button. Selecting the button will set the associated property to this value.The width of the button.The horizontal coordinate of the upper left corner of the bounding rectangle of the radio button.The vertical coordinate of the upper left corner of the bounding rectangle of the radio button.RegistryForeign key into the Component table referencing component that controls the installing of the registry value.RegPathThe key for the registry value.The registry value name.RootThe predefined root key for the registry value, one of rrkEnum.The registry value.RegLocatorThe table key. The Signature_ represents a unique file signature and is also the foreign key in the Signature table. If the type is 0, the registry values refers a directory, and _Signature is not a foreign key.An integer value that determines if the registry value is a filename or a directory location or to be used as is w/o interpretation.RemoveFileForeign key referencing Component that controls the file to be removed.Name of a property whose value is assumed to resolve to the full pathname to the folder of the file to be removed.WildCardFilenameName of the file to be removed.InstallModeInstallation option, one of iimEnum.RemoveIniFile2;4The type of modification to be made, one of iifEnum.Foreign key into the Component table referencing component that controls the deletion of the .INI value.The .INI file name in which to delete the informationThe value to be deleted. The value is required when Action is iifIniRemoveTagRemoveRegistryForeign key into the Component table referencing component that controls the deletion of the registry value.The predefined root key for the registry value, one of rrkEnumReserveCostReserve a specified amount of space if this component is to be installed.ReserveFolderReserveKeyPrimary key that uniquely identifies a particular ReserveCost recordReserveLocalDisk space to reserve if linked component is installed locally.ReserveSourceDisk space to reserve if linked component is installed to run from the source location.SelfRegCostThe cost of registering the module.Foreign key into the File table denoting the module that needs to be registered.ServiceControlArgumentsArguments for the service. Separate by [~].Required foreign key into the Component Table that controls the startup of the serviceBit field: Install: 0x1 = Start, 0x2 = Stop, 0x8 = Delete, Uninstall: 0x10 = Start, 0x20 = Stop, 0x80 = DeleteName of a service. /, \, comma and space are invalidWaitBoolean for whether to wait for the service to fully startServiceInstallArguments to include in every start of the service, passed to WinMainDependenciesOther services this depends on to start. Separate by [~], and end with [~][~]Description of service.DisplayNameExternal Name of the ServiceErrorControlSeverity of error if service fails to startLoadOrderGroupInternal Name of the ServicePasswordpassword to run service with. (with StartName)ServiceTypeType of the serviceStartNameUser or object name to run service asStartTypeCatalogSFP CatalogDependencyParent catalog - only used by SFPFile name for the catalog.ShortcutThe command-line arguments for the shortcut.Foreign key into the Component table denoting the component whose selection gates the the shortcut creation/deletion.The description for the shortcut.Foreign key into the Directory table denoting the directory where the shortcut file is created.HotkeyThe hotkey for the shortcut. It has the virtual-key code for the key in the low-order byte, and the modifier flags in the high-order byte. Foreign key into the File table denoting the external icon file for the shortcut.The icon index for the shortcut.The name of the shortcut to be created.ShowCmd1;3;7The show command for the application window.The following values may be used.The shortcut target. This is usually a property that is expanded to a file or a folder that the shortcut points to.WkDirName of property defining location of working directory.SignatureThe name of the file. This may contain a "short name|long name" pair.LanguagesThe languages supported by the file.MaxDateThe maximum creation date of the file.MaxSizeThe maximum size of the file. MaxVersionThe maximum version of the file.MinDateThe minimum creation date of the file.MinSizeThe minimum size of the file.MinVersionThe minimum version of the file.The table key. The Signature represents a unique file signature.TextStyleColorA long integer indicating the color of the string in the RGB format (Red, Green, Blue each 0-255, RGB = R + 256*G + 256^2*B).FaceNameA string indicating the name of the font used. Required. The string must be at most 31 characters long.SizeThe size of the font used. This size is given in our units (1/12 of the system font height). Assuming that the system font is set to 12 point size, this is equivalent to the point size.StyleBitsA combination of style bits.Name of the style. The primary key of this table. This name is embedded in the texts to indicate a style change.TypeLibThe cost associated with the registration of the typelib. This column is currently optional.Optional. The foreign key into the Directory table denoting the path to the help file for the type library.Required foreign key into the Feature Table, specifying the feature to validate or install in order for the type library to be operational.The language of the library.LibIDThe GUID that represents the library.The version of the library. The minor version is in the lower 8 bits of the integer. The major version is in the next 16 bits. UITextA unique key that identifies the particular string.The localized version of the string.UpgradeActionPropertyThe property to set when a product in this set is found.The attributes of this product set.A comma-separated list of languages for either products in this set or products not in this set.RemoveThe list of features to remove when uninstalling a product from this set. The default is "ALL".UpgradeCodeThe UpgradeCode GUID belonging to the products in this set.VersionMaxThe maximum ProductVersion of the products in this set. The set may or may not include products with this particular version.VersionMinThe minimum ProductVersion of the products in this set. The set may or may not include products with this particular version.VerbOptional value for the command arguments.CommandThe command text.Order within the verbs for a particular extension. Also used simply to specify the default verb.The verb for the command.TARGETDIRDefaultFeature_0432E061A4E73AD808B89F54CCAA6BA9C__0432  !"#$%&'()*+,-./01235689:;<=@ABDFGIJKLMNOPRSTUVWXYZ[\]^_`acdhfijuoqtvwy}%%%'''+++,,,---.......7788=========BBBBPPPPPPPPTTXXZZZZZZZZ_``dddddddddddddmmmmmmzz!!!!!!!!......55566677<<????BBBBBFFFFFQQQQQQbbbddd     #############::::::::::::JJJJJJJJJ[[[[[eeeeeeeemmppppppp}}}}}          # ')O' ') ') ').3261/58:8bA=J HD>BO RP >UY\Zl >):8bjol~ ewy|qgO>m>'U y|8b:lJ HD>8HD> 'g'Rl :\lYbllO^`jOlY57Y! %+)b l: +)/ ') '):8' 8b8bCIGOKTXVR[mffllO>lbYbl Yl bl YY)>lO8bJ HD)bl:)l % %+)b l )llY!l#(04*,%2.l :l ?y|DHJ XRVPTNL[^`\bjl O)w{y>uq`})g'   HH&HHH&HHH22222&2&&@HHHHHHHH@& H&H &H&HHH&HH@@H&HHHH2222H222H22H22HHHHHHHHHHHHH222H@&@&&HHHHH`HH`HHHHH@@H@@HH @ HHHH HHHHH&HHHH HHH&H(HHHHHHH HHHHH&&&H&H@@2HHHHHHHH`HHHHHHHHHHHHHHHHHHH &HH&H&H %'+,-.78=BPTXZ_`dmz!.567<?BFQbd #:J[emp}  Oh+'0p  (8DP X d@Windows Installer Intel;1041'{393C64E8-A443-4D5E-8A23-79DF45FEF152}҂ɂ1021seiwa@~@~'''+++,,,---....pqooo    !#%')+-/1   "$&(*,.0!!!!uu\\\\VV2222222222  %  %;=?ABCDELes3=K222222222222222222222222222222222222222222222222uuuuuuuuuui9uuuJiuuuuuN߀eN'#'nnnnnnnnnnnnnnnnnnnnN:NAANNf:NNNNNN:NAAN:NNNNKKKKK:KAKKK:JKKKKHKNN8:HKNNNNNvvwwAKKAA];=??????AABCDDDDDDEELLLLeesssssssssss3333333====KKKKKKKHKNN8:HKNNNNNvvwwAKKAA]_HKNNK ghjkl88::JLNHKNNHKNNHKNNNNNNvvwwKllfulflllfulflifillliffilffllulvwifilflllllllllplpllllifilifiliffilfffkkekekkkekekmehknkekkktkttekek|xyz{}~kqkonsrkekekeke_gj@H?AAxDBDAED1H-~@H C1A5G ' C1A5G=?K;;J;U=!l0@HYEDhE7G |x C1A5G?\;;;<%L+@HDjEA(H  @HAEFAE(?(E8BA(HZ@HArD E061A4E73AD808B89F54CCAA6BA9AxInterop.MCIneutralCulture1.1.0.0{AEC699C1-8E00-04CE-C615-E3AA4B7E729D}0AXINTE~1.DLL|AxInterop.MCI.dll_242573C7BE41F6324814B467B9E859AEC__242573C7BE41F6324814B467B9E859AEAxInterop.SHDocVw{9289D19C-9BF0-A5F8-6CC3-18046DFE464D}AXINTE~2.DLL|AxInterop.SHDocVw.dll_3871AEFEE44E691827DF9986ADCCA134C__3871AEFEE44E691827DF9986ADCCA134Interop.SHDocVw{E898681E-9873-D66A-FCD0-B688C43986BE}127INTERO~1.DLL|Interop.SHDocVw.dll_559F7BEAF77546C886DA631ED8D02134{166D6667-4805-C69D-7A7C-AF8857AFAAED}C__559F7BEAF77546C886DA631ED8D02134PP2.ICO|pp2.ico_78449766E41CEC5A824CF22925D86504C__78449766E41CEC5A824CF22925D86504stdoleB03F5F7F11D50A3APublicKeyToken7.0.3300.0{03C21BBC-8A48-CE06-1A94-38DAB2AA3478}10337.0.9466.0STDOLE.DLL|stdole.dll_CA907B710CA46B0A444F1F03A4DA7830SystemFolder{7A6A3328-27A1-A26C-0B40-77AA36D465DF}C__CA907B710CA46B0A444F1F03A4DA78306.0.84.18MCI32.OCX|MCI32.OCX_E5A5DAFB16090413BDD0DC1BF871958BC__E5A5DAFB16090413BDD0DC1BF871958BInterop.MCI{84770894-486C-9A37-FEF4-76E91C921114}INTERO~2.DLL|Interop.MCI.dllSourceDir[ProgramFilesFolder][Manufacturer]\[ProductName]DIRCA_TARGETDIRTARGETDIR="".:VXetH~1|VXe tH_.:[U[̃v~1|[U[̃vO j[ProgramMenuFolder҂ɂ~1|҂ɂ_B310636F8F85448688AC28574001048E{2AA431FE-A828-4B8F-ACDA-FF3C738436B0}C__746C69616E6711D38E0D00C04F6837D0_0A399E9F6D354D08A64D1AB10A00F9D4.:[U[̃f~1|[U[̃fXNgbvDesktopFolder_VsdLaunchConditionUrlURL to navigate to when condition fails and install must abort.http://go.microsoft.com/fwlink/?LinkId=9832[VSDNETURLMSG]VSDFXAvailableMSVBDPCADLLCheckFXDIRCA_CheckFX1.1.4322VSDSupportedRuntimesVSDNETCFGVsdLaunchConditionsVSDCA_VsdLaunchConditionsNOT Installed҂ɂ1021ProductNameProductCode{7A802766-A4BE-4470-B6B4-6117C99D909D}1.0.0ProductVersionseiwaManufacturerARPCONTACT1041ProductLanguagePREVIOUSVERSIONSINSTALLED1.0.0.0SecureCustomPropertiesNEWERPRODUCTFOUNDPREVIOUSVERSIONSINSTALLED;NEWERPRODUCTFOUND[VSDVERSIONMSG]ERRCA_CANCELNEWERVERSIONNEWERPRODUCTFOUND AND NOT Installed[V.Fr2P2BB2wwwBbbQQ>QQQQQAA\QYY!4!4!4*03w02468:357/13579346sLs !!&BCDEL>@a        !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     # '!"&$%).(:*+,-1/023456789;f<=>?@ABCDEFHITKLMNOPQRSUVWXYZ\]^_`abcdeuvwxyz{|}~MZ@ !L!This program cannot be run in DOS mode. $e ^^^! ^^'^^ ^^c ^^^^! ^}^c ^^! ^^! ^^! ^^! ^^Rich^PEL<x>!  ZV@v*XyH.text6 `.data. @.rsrc@@.reloc Y`@B̖ޖBTdvƒܒ*D\t̓ړ.DXh0zȔ&8Lʕޕ&L\n@4$ڙdVH: Ԙ˜vl`L8* ܗЗėxr\ 9H"03 s9t4/|J}gvr 1@xtPy3֑Ƒ2<x>!yyZVZVtZVhZV\ZVPZVHZVDZV8ZV0ZV$ZVZVTypeLibSoftwareSYSTEMSECURITYSAMMimeHardwareInterfaceFileTypeComponent CategoriesCLSIDAppIDZVZVZVZVZVZVZVZVDeleteNoRemoveForceRemoveValBDMS#F_|ZVm|ZVSELECT * FROM `%s`[V[V[V[V[V ~ZV?ZVZV~ZVy~ZVZV#ZVýZVFAILED RESULT Reconstructed URL: http://%s:%d/%shttp://%s/%sTASK Read the port number from _VDirToUrl Table has value RESULT Property TASK Read the virtual directory from _VDirToUrl Table ProductNameFALSETRUERunning show message with fUseMessageBox = VSDINVALIDURLMSGHideFatalErrorFormopenExecuting URL '[1]' with source directory '[2]'SourceDirRESULT Condition is false RESULT Condition is true. Nothing more to do. ' TASK Evaluating condition 'TASK Getting the condition to evaluate A launch condition has already fired. My work is done here. Checking a launch condition ?ZVZV~ZVy~ZVZVZV[VRESULT Custom Action Succeeded _VDirToUrlRESULT Local name ComputerNameTASK gethostbyname - Look up host by name TASK gethostname TASK WSAStartup TASK CoInitializeEx - COM initialization Free Threaded TASK CoInitializeEx - COM initialization Apartment Threaded WEBCA_CreateURLs.LogAttach Debugger To MeCreateURLsVSCADEBUGATTACHTASK MsiRecordGetStringW - Setting Property Value TASK MsiRecordGetStringW - Getting Property Name Try Again FAILED Error Not Enough Memory TASK Allocating memory for szProperty TASK Getting Property Name to Mapped to RESULT bstrDir = FAILED Error Path Not FoundTASK MapURLToHardDriveLocation - Mapping URL to Destination UNC RESULT bstrURL = /http://RESULT URL is not valid. TASK IsValidHttpURL Validating URL - szURL = TASK MsiGetPropertyW - Getting Property Value Try Again TASK Allocating space for szURL TASK MsiGetPropertyW - Getting Property Value TASK MsiRecordGetStringW - Getting Property Name FAILED Error Not Enough MemoryTASK Allocating Memory for szURLProperty TASK MsiRecordGetStringW - Fetching key of current row in _UrlToDir Table TASK MsiViewFetch - Fetching each row from _UrlToDir Table TASK MsiViewExecute - Open Database view on _UrlToDir Table TASK MsiDatabaseOpenViewW - Prepare Database to view _UrlToDir Table FAILED Error_DataBase_Does_Not_ExistTASK MsiGetActiveDatabase _UrlToDirWEBCA_EvaluateURLs.LogEvaluateURLsWEBCA_ToggleNearestAppRoot.LogToggleNearestAppRootFAILEDINFO Getting Application Name. TASK Creating at URL TASK Deleting approot at URL TASK Creating approot at URL INFO Update property is not set. INFO Getting update property. _UpdatedWEB_CA_RESULT Custom Action Succeeded. uiRet = _VsdLaunchConditionVSDCA_VsdLaunchConditions.LogVsdLaunchConditionsZVZV"ZVDZVUZV+ZV+ZVfZV8ZVmZV[V[V[V[V[V[V[V[V[VZVZVnZVyZVnZV_AppRootCreateWEBCA_CreateAppRoots.LogCreateAppRoots?ZVZV~ZVy~ZVZVkZVýZVVSDFXAvailableTASK Checking if specified runtime is available VSDFxConfigFileTASK WriteFile TASK CreateFile CFGTASK MsiRecordReadStream TASK MsiRecordDataSize TASK MsiViewFetch TASK MsiViewExecute SELECT `Data` FROM `Binary` WHERE `Name` = 'VSDNETCFG'TASK MsiDatabaseOpenView 1.1.4322TASK Set default VSDNETMSG VSDNETURLMSGVSDNETMSGTASK Set VSDNETMSG with the first version in SupportedRuntimes list VSDSupportedRuntimesDIRCA_CheckFX.LogCheckFXVSCADEBUGATTACHvsdeploy.chmu8dv~SELECT `Extension`, `ExePath`, `Verbs` FROM `_AppMappings` WHERE `Directory_` = '%s'SELECT * FROM `%s`TASK Setting IIS Property with SetData Not setting the AppIsolated property! TASK Closing key TASK Adding key 'TASK Opening key 'TASK Deleting key '' to see if it can be deleted FAILURE Failure to get token. RESULT Token is 'TASK Getting web folder property token. 1RESULT Property = TASK Getting dword IIS Property TASK Getting string/multisz IIS Property "RESULT Key path is 'TASK Extracting the key path from the property RESULT Marked string is '\N\TASK Marking escape sequences for '\|"RESULT Data not found while getting IIS property for rollback (ignore above failure) \""|"|"|"*,1FAILED No ']' found in the exe path TASK Finding ']' in the exe path ,.TASK Closing app mappings view TASK Fetching app mapping record FAILURE Failed to get the key path from the URL TASK Getting the key path from the URL TASK Searching for ',' in RESULT Marked app mappings = 'RESULT Marked buffer = 'TASK Closing key to the directory with CloseKey TASK Deleteing data for property |TASK Getting METADATA_HANDLE for the directory 'TASK Saving metabase data RESULT Open failed RESULT Open succeeded FAILURE Failed to create metabase object TASK Creating metabase object CustomActionDataWEBCA_ApplyWebFolderProperties.LogApplyWebFolderPropertiesRESULT 'TASK Splitting property WEBCA_RollbackApplyWebFolderProperties.LogRollbackApplyWebFolderPropertiesWEBCA_RollbackApplyWebFolderPropertiesWEBCA_ApplyWebFolderProperties_IISPropertiesWEBCA_GatherWebFolderProperties.LogGatherWebFolderPropertiesSELECT `_URLProperty` FROM `_UrlToDir` WHERE `TargetProperty` = '%s'SELECT `Directory_Parent`, `DefaultDir` FROM `Directory` WHERE `Directory` = '%s'TASK MsiViewExecute - Open Database view on table TASK MsiDatabaseOpenViewW - Prepare Database to view table TASK Enumerating table using SQL statement: TASK MsiGetPropertyW - Getting Property TASK Allocating space TASK MsiGetPropertyW - Determine size of property to TASK MsiSetPropertyW - Setting property TASK MsiSetPropertyW - Setting Property Value TASK MsiRecordGetStringW - Getting value from column TASK MsiRecordGetStringW - Fetching value TASK MsiRecordGetInteger - Getting value from column TASK MsiGetTargetPathW - Getting Target Path for 'FAILED Memory allocaton failed TASK Allocating space for target path TASK MsiGetComponentState - TASK MsiDatabaseOpenViewW - Using query 'VSCADEBUGLOGRESULT URL: RESULT RootURL: RESULT RootDirectoryURLProperty: RESULT DirectoryProperty: RESULT RootDirectoryProperty: I640pʶ"P "PDsaSO/:*?"<>|:\ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz\\file://%d.%d.%d.%du6[VF6[VJ6[VJ6[Vq6[VJ6[VJ6[V*)SO*)SOgetnameinfofreeaddrinfogetaddrinfows2_32.dll1080socks70gopher21ftp443https80http:///ROOT/LM/W3SVC/ServerStateServerBindings/W3SVC][:IIsWebServerIIS://ADsEnumerateNextADsFreeEnumeratorADsBuildEnumeratorADsGetObjectactiveds.dllIIsWebVirtualDirSuccessfully created AppRoot Calling AppCreate with inprocflag = Calling AppCreate2 with inprocflag = Remainder: Root thus far: Opening key The app root is: to hard drive location Mapping VSD_FORCE_ANSIr..\.esqɴ 1zuǒ؞\[VF6[V\[V\[Vvv1.0.3705 "/> GetCORVersionCorBindToRuntimeHostMSCOREE.DLLZVZVZVZVZVZVZVZV='%{} ~,\;TYPELIBc[Vc[VHKEY_CURRENT_CONFIGHKEY_DYN_DATAHKEY_PERFORMANCE_DATAHKEY_USERSHKEY_LOCAL_MACHINEHKEY_CURRENT_USERHKEY_CLASSES_ROOTHKCCHKDDHKPDHKUHKLMHKCUHKCRHZVHZVHZVHZVHZVxHZVpHZV\HZVHHZV4HZV(HZVHZVHZVGZVFFPo[VVe[Vae[Vn[Vn[V9o[V1o[V1o[Vێ[V1[VAPPIDp[Vp[Vp[Vt[Vm[Vp[VFp[Vp[Vp[Vt[Vm[Vy[VREGISTRYModule_RawModule[VVe[Vae[Vn[Vn[V9o[V1o[V1o[VՒ[Vؓ[VZVZVZVZVZVZVZVZV&@axձGNF5=T| FJDo_IH:{{)1B2M#[f esEL}svrapi.dllnetapi32.dllNetShareCheckNetShareGetInfoNetApiBufferFreeyumlyumlyacuteyacuteuumluumlugraveugraveucircucircuacuteuacutethornthornszligszligquotquotoumloumlotildeotildeoslashoslashograveograveocircocircoacuteoacutentildentildeltltiumliumligraveigraveicircicirciacuteiacutegtgteumleumlethethegraveegraveecircecirceacuteeacuteccedilccedilaumlaumlatildeatildearingaringampampagraveagraveaeligaeligacircacircaacuteaacuteYacuteYacuteUumlUumlUgraveUgraveUcircUcircUacuteUacuteTHORNTHORNOumlOumlOtildeOtildeOslashOslashOgraveOgraveOcircOcircOacuteOacuteNtildeNtildeIumlIumlIgraveIgraveIcircIcircIacuteIacuteEumlEumlEgraveEgraveEcircEcircEacuteEacuteETHETHCcedilCcedilAumlAumlAtildeAtildeAringAringAgraveAgraveAcircAcircAacuteAacuteAEligAElig0123456789abcdef0123456789abcdef[V[V[V[V2[V[V[V[V%%%02xFailure in DISPID ZVZVZVZVZVZVZVZVZVZVZVZVZVZVZVZVyZVũ[V,y)OrĤ3OLݛ,OZݛ,Ȏݛ,OR^ݛ,OʇǸݛ,O7OԮ nOP0ͪЋOy4x !nOP)[ѯz62Pѯz6emlѯz6.fѯz6. 74OWH34OѢ~5Oѣ~5Oѣr%6OPO'&6OP 'h9 Oqy9 ORiwOPܩP@OP@OP@OPIq@OP7;변@OP@OPܽ@OP)zFOP({FOP3f{FOPܩFOPGOPܾKeOknO x!O"\Dw=w`uSV`uSDLL load failed due to incompatible .NET Runtime versiona[Vr[VӮ[V׮[V[V[Vn[V`[V8zZV[V[Vcsm [V[V9[VCorExitProcessmscoree.dll[V[V[VFlsFreeFlsSetValueFlsGetValueFlsAllockernel32.dll[VA[VE[V[V[Vruntime error TLOSS error SING error DOMAIN error R6029 - This application cannot run using the active version of the Microsoft .NET Runtime Please contact the application's support team for more information. R6028 - unable to initialize heap R6027 - not enough space for lowio initialization R6026 - not enough space for stdio initialization R6025 - pure virtual function call R6024 - not enough space for _onexit/atexit table R6019 - unable to open console device R6018 - unexpected heap error R6017 - unexpected multithread lock error R6016 - not enough space for thread data This application has requested the Runtime to terminate it in an unusual way. Please contact the application's support team for more information. R6009 - not enough space for environment R6008 - not enough space for arguments R6002 - floating point not loaded Microsoft Visual C++ Runtime Library Runtime Error! Program: ...Program: A buffer overrun has been detected which has corrupted the program's internal state. The program cannot safely continue execution and must now be terminated. Buffer overrun detected!A security error of unknown cause has been detected which has corrupted the program's internal state. The program cannot safely continue execution and must now be terminated. Unknown security failure detected!S[VW[V[VX[V\[V[V[V[V h(((( H   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~[V[V|[V[V [V[V[V[V[Vo[Vs[V[V[V?[VC[V ((((( H h(((( H H\V\VEEE50P (8PX700WP `h````ppxxxx(null)(null)(\V"(\V&\V&\V&\V&\Ve+000?~PAGAIsProcessorFeaturePresentKERNEL322\VInitializeCriticalSectionAndSpinCount 3\V3\VGetProcessWindowStationGetUserObjectInformationAGetLastActivePopupGetActiveWindowMessageBoxAuser32.dll6\V6\V7\V7\VHH:mm:ssdddd, MMMM dd, yyyyMM/dd/yyPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunq<\Vu<\V>\V>\V@\VC\VP\VSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec*S\VmT\VU\VU\VfY\V1#QNAN1#INF1#IND1#SNANc\Vc\Vyg\VY/(e =L9o<{OyzQN24ɡJN;o~S$F$9h ɧE${PgRGL)S 3E<@f5$K&ost8l` GY7F#qQMՐ?MaŪѲY]O  &iQGiW',Ím2K@Rm ZxPJMh|I(Q]ԐƕKOΣVkQ!tMWz.g NQPu-;E+V[w-fHhԁ '(@ĺDÆJwLtJ XnOJiPByiEzFOom F*+KyD '`mJU@,Bq 0?PrKiϝnMvKK5ٟJ[3ů`ҐkcNQēAm:ZRC~{3Yh@EZw `OM 茯.BARޜC϶Mg8 al{ Ai :kgԧM~ D!$\Z=86D/^BFH.tC50]LM w!K|~0H Iu*znJE,~3DE_E5P[M(CÏ*lhlO`? W}"wDuJoVgOI' B(]Lw E'й=Ys)ǛJNկܱ%A[9 ~= No&U|JwԨ)5E@8ӼbK4^KP0 a Nۧǵ q gKL\` `PuC磻On?7 Hw9;!gCIZVb@TBɈݢx#CwXMN˵k_s:C~'wǾ-DxS4;E[CW<@\ȝ/mDPJ=-s^ܻMOTz0J8Ep>Pݛ@,oH#ɢjxLCnc!OYP}n?¹L|sh.%FT,Rؐ0ì@pARl97Iz)ݡdBjakZֆMioPUC e3ż!c,aJU/= i*5J Z>ϞTCkq)mI&QN 6X%i _wJ/z 0嘅cf+RX@e7pC|2A{·u~ G*ZE〴ږLĦROR]:)KKKVUj)M@h|C?SAgy,֒g4ǰEs_G=UOj9L} @,5 vrkM B'HJZԳ@9#ᒅ ֩O1& }z^Zp%A_Q }z^Z pd6M'zAU \eAUIEexxvCQk%C?7DML?.Sf JBSWeC`Sz[DBcE]I+<KΖ^CpsdG9c (E`@C4C*jűJ[;PMVCі ܗPMZáB ֱGN#G.c)uG,g $!35:@^h@!fE)/'!SB˔D$y}RPHCz hvE<Ŷ>(a;K[PoM=KǠޝ9zf8AWEXOWp.] -bFL5RB`eL|~EP Xvr@DqI=bFI;(F;R iFVryl·FSGK S_ҵ#@6_NDcXJU`%:U4,DC]>DQ( ܋DD2ֆqoO`EPCa|mFxˠ hKo5~vMIkzLQ]w؎P=De[N)"DdB U)СMB: %M81Ji)۟Q28K̩meOneg6Ѕ}OgM}[/+[KPS`@ rAPLP.0ժceJÅs*.Rx[WbuDl[19!PQx>!L-f_;:B^fEkɤBW>MHZ[>=D6՟ rH4r^CY)؜ <{@%Mv`̻yxK_˵>jo>AGQ+i_z#7Jrj.H<~L=FX_I q?>wް!G8ܾXLDiF򂨺4h=-E̹b蘛ؾnCAfLI46/IO EA#NN27PH:y5a-C"H'>XB+aF]g2&s{xBrbB,lG@9@TY:$+e Hm OHwPF> j]Ml$OPpD:Š GGw8bMw,j6*t9-)D[x]L"=.|CKVO0;eLr=np膠 NJ8&{}[Ҵ="Fϟh_9/6VPO*JJVVVVddpp~~  H\VPzZVCRSDSZL>DBDPCA.pdb\VyZVyZV\VyZV\VzZV zZV\V(zZVLTn o:otoooUpppppp*qu^VFtPG,6tV;,^U W39}tm9} thSV`\V5DZVWWu Eu}WPփ} uCPWZV;ljEtSPu uWu;t uZV}MT^[3_øn\V[:8SVWeh@ju3ۉ] uMl9<\V=<ZVt+SEPZVVPV5<\V5HZV;u@\V5HZV]ԉ]MEPju E袑;}P)YMEPuɋ;}P)Y9]u hGZVMzuM趩j/j\MEL9<\VOSEPhtZVPhtZV5<\V;u@\V9<\VESMQPEPu5<\V;u@\V9<\VSEPh\ZVPh\ZV5<\V;u@\V9<\VuMEuMErMȋ ESEPQPu5<\Vu܉EZVuZV9]u@\V9<\VtTSEPhTZVPhTZV5<\V;u@\V9<\Vt&SEPhZVPhZV5<\V;u@\VEP]؉]MEPju Eӏ;}P'YMEPu;}P'Y9]tuZV;vj Su2 E9<\VSEPhtZVPhtZV5<\V;u@\V9<\VESMQPEPu5<\V;u@\V9<\VSEPh\ZVPh\ZV5<\V;u@\V9<\VtTESMQPEPu5<\V;u@\V9<\Vt&SEPhTZVPhTZV5<\V;u@\VMxuEW:Yu5}PuEuuhZVPD!uuhZVP. uML9<\VSEPhxZVPhxZV5<\V;u@\V9<\VuMgEuME UMċ ESEPQPu5<\V9]܉Et uZV]9]t uZV9]u@\V9<\Vt&SEPhTZVPhTZV5<\V;u@\V]̋MEPju E R;}P_%YuMu诊;ÉE}PC%YuZVMӢuZVuZVM蹢uZVuZV9]tCuZV8MAE3;tVSZVVP9<\Vt&SEPh`ZVPh`ZV5<\Vօu@\VuZV3;t9<\Vt&SEPh(ZVPh(ZV5<\V;u@\VE]ȋMEPju E譅;}PYjf]]:EuESP;t~ % PYuh$u]MEPju E;;}PHYj]uuESV;t~ % PYEPEPVu=u^9]tYEEP$-;Yu hLYEPWVuEWMWs#;Yt~ VY=PZVSSSSjuSS;Ë5LZVEuօ % PYu,;YEu hYSSuujuSS;uօ % PY]MEPhZVE%~;}PY9]uZV;v~SSSSjuSS;ÉEuօ % PYu+;YEu hYSSuujuSS;uօ % PYjhZVSVujV9]EuZVPjVVhujuSuhZVSZV;tVju5ZV9]tuRuE֋Mh,ZVhZV%;}PY9]EtuuZVEWuZV,MAE3;tVSZVVPZV39]t u !Y9]t u YEM_^d [Vt$}P^|$Vtjt$ 7YYu h&^VD$tV Y^VF t x r3uPN uFAN HF t$p F^VW~ APO;|$ F wt$OF _^AH 9L$r )L$@u@L$3ZVHH HHV?D$tVY^o\V)\VSVWEeL3PSL]ZVSShZV̠\V;vShZVhZVSZVhtZVuŌ9<\V=<ZVYYt.STPZVVPV5<\V5HZV;u@\V5HZVjSZV;ÉP9<\VSTPhhZVPhhZV5<\V;u@\V9<\VSTPjh\VP  PPjh\VP  P5<\V;u@\V9<\VtZSTPhTZVPhTZV5<\V;u@\V9<\Vt)STPhZVPhZV5<\V;u@\VSSZV;ÉPE@D]9<\VEt)STPhXZVPhXZV5<\V;u@\VXPjE9<\Vt)STPh0ZVPh0ZV5<\V;u@\VhP;9<\Vt)STPhZVPhZV5<\V;u@\VSSSSSPf;tP;t8PT0ME9TEt TZVK9]uEPhZV@x;}PY9<\VSTPhZVPhZV5<\V;u@\V9<\Vt`ESHQPTPT5<\V;u@\V9<\Vt)SHPhTZVPhTZV5<\V;u@\VPh|ZVPh ZVPEӛ u@hZVPvs;}PY9<\Vt9SHPh8ZVPh8ZV5<\Vօu@\V<\V;tPTZVZVP5uZV@3-;ÉHt'T8H;Y~ % P Y9<\Vt)SPh0 ZVPh0 ZV5<\V;u@\VDP0PTDžDuf0;ÉHn=t'TH;Y~ % P< Y9<\Vt)SPhZVPhZV5<\V;u@\VDDP;YPuHT'9<\VYt)SPh ZVPh ZV5<\V;u@\Vh Y9<\Vt)SPhpZVPhpZV5<\V;u@\VDPPTu TH9HYt'PyH;Y~ % P Y9<\VSPhZVPhZV5<\V;u@\V9<\Vt\SPPPP5<\V;u@\V9<\Vt)SPhTZVPhTZV5<\V;u@\VTPE讟:Y9<\VtZSPhZVPhZV5<\V;u@\V9<\Vt)SPhXZVPhXZV5<\V;u@\VXPj 9<\Vt)SPh0ZVPh0ZV5<\V;u@\VhP ;9<\Vt)SPhZVPhZV5<\V;u@\VSSSSSP;tP2 ;tchZVTP@PTE@EZVhZVTMPT< PTL9<\VSPhZVPhZV5<\V;u@\V9<\Vt\SPTPT5<\V;u@\V9<\Vt)SPhTZVPhTZV5<\V;u@\VPlY<9<\VEt)SPhZVPhZV5<\V;u@\VY^*q\V`\VSVuW3EeP}WEZVWWh,ZV\ZVvWh+ZVhZVWZVh+ZVV?[9=<\V<ZVYYt.WPZVVPV5<\V5HZV;u=@\V5HZVjWZV;lj9=<\VWPhhZVPhhZV5<\V;u=@\V9=<\VWPjh\Vs PPjh\VX P5<\V;u=@\V9=<\VtZWPhTZVPhTZV5<\V;u=@\V9=<\Vt)WPhZVPhZV5<\V;u=@\VWWZV93Ph+ZVEG;lj}PfY9ZV;Dž (ZVPj;E 9=<\Vt)WPh +ZVPh +ZV5<\V;u=@\VW}0h +ZVuP WX0h*ZVuPE軸i9=<\Vt)WPh*ZVPh*ZV5<\V;u=@\Vh*ZVh +ZVuPh*ZVh*ZVuPm9=<\Vt)WPh$ZVPh$ZV5<\V;u=@\Vu;ljEu h@hY9=<\Vt)WPhh*ZVPhh*ZV5<\V;u=@\VEmPh)ZVu?;~ % ;lj}PY9=<\Vt)WPh)ZVPh)ZV5<\V;u=@\VW;~ % ;lj}PoY9=<\Vt)WPh)ZVPh)ZV5<\V;u=@\VE蒷PZ;~ % ;lj}PY9=<\Vt)WPhl)ZVPhl)ZV5<\V;u=@\Vj;lj@P_;Yu hY3ʃ=<\Vt'jP4)ZVWPW5<\Vօu!@\VPj~ % }PYPh\Vu h@YPjh,)ZVP\Vu h@Y=<\Vt'jP)ZVWPW5<\Vօu!@\V3WhjWWhPؠ\Vu h@yY9=<\Vt'jP(ZVWPW5<\Vօu!@\VjPTZVu hYPh(ZVE3;lj}PGY9tY9}tu39=<\Vt)WPh`(ZVPh`(ZV5<\V;u=@\V#P YYt&h,ZVh<(ZVE;lj}PY9=<\Vt6WEPh8ZVPh8ZV5<\Vօu=@\V<\V;tPTZVZV9t 9t ZV;3]t Yt PXZV}tuR,ZVÃ|jZV5HZV<ZV3;lj}t PQ9=<\VWEPhhZVPhhZV5<\Vօu=@\V9=<\VWEPjh\Vi PPjh\VN P5<\Vօu=@\V9=<\Vt6WEPhTZVPhTZV5<\Vօu=@\V<\V;tPTZVZV%Md M_^[A3tVjZVVPCZVU E=8VWu<39=<\Vt+WEP-ZVV<ZVPV5<\VHZVu=@\V3"=<\V5HZV=<ZVEEEEEEEE EE$SEt$jEP`-ZVSPS5<\Vօu!@\VEUR3Su PQ$;ÉE9<\VSEPhZVSPS5<\Vօu!@\V=<\VtmjEPj\VSu PPjSum P5<\Vօu!@\V=<\Vt$jEPTZVSPS5<\Vօu!@\VE[_^à S\$,UVW3Sl$ZV;ʼnD$tLCf9/uHf)II;ʼnD$u5HZV=<ZVD$9-<\Vt}UD$$PhT.ZVPhT.ZV5<\Vօu-@\V9-<\VtNUD$ PSPS5<\Vօu-@\V9-<\Vt'UD$(PhZVPhZV5<\Vօu-@\VD$4T$RhjSUPQD=u D$f_^tu h_^zq\VNSVu3;PZV;ÉEW]PM]9<\V5HZV=<ZVt~SEPhH1ZVPhH1ZV5<\V;u@\V9<\VtPSEPuPu5<\V;u@\V9<\Vt&SEPhZVPhZV5<\V;u@\VMhGZVPh/ZVM9]E]vaMEHEf;t3"t\tMfMEP"Mh@1ZVαEf׋Mh81ZV蹱EE;Er9<\VSEPh1ZVPh1ZV5<\Vօu@\V9<\VtVESMQPEPu5<\Vօu@\V9<\Vt&SEPhZVPhZV5<\Vօu@\Vu5ZVu_M^[d øzq\VBSVu3;PZV;ÉEW]PM] 9<\V5HZV=<ZVt~SEPhH1ZVPhH1ZV5<\V;u@\V9<\VtPSEPuPu5<\V;u@\V9<\Vt&SEPhZVPhZV5<\V;u@\VMhGZVDh/ZVM 9]E]v\MEHEf;t.\tMfMEP"Mh@1ZVǯEf׋Mh81ZV貯EE;Er9<\VSEPh1ZVPh1ZV5<\Vօu@\V9<\VtVESMQPEPu5<\Vօu@\V9<\Vt&SEPhZVPhZV5<\Vօu@\Vu5ZVu_M^[d øq\V;QQVW3}EPu}uuuu u;u%EPYM EPӜM hp0ZV蛮J uB9=<\Vt+WEP1ZVV<ZVPV5<\VHZVu=@\VM h1ZVQ3uZVM_^d øq\VyLSVWe@Vju3ۉ] Vju ]MEPju E/;}P Y]ċMEPuEM>;}PY]9<\VEt+SEP4ZVV<ZVPV5<\VHZV;u@\VEPu=];YY}MEP$jh"jVujVVhu;tV9<\Vt+SEP3ZVV<ZVPV5<\VHZV;u@\VWYEPYMEPMhp0ZVɬMEPju @1E9]EE} uEY3tj_tt%+t"@t@t hWY j\VVWM PBMp0ZVW4E@tjVPlM PMW3Eu@jVPEM PMW߫3E t@jVPM PMW踫MԸ#3t#t;t hW-Y 3Gj_3jVWM PdMp0ZVVV]̋MEPju EW-;}PdYEPYMEPHMVM] CuEh,ZVPEKM EPu<6;}PY]]܉]ԉ]؉]5ZVE ]9<\Vt+SEPX3ZVW<ZVPW5<\VHZV;u@\VEPuk=9<\Vt+SEP3ZVW<ZVPW5<\VHZV;u@\Vuu% ;ÉE}P<Y8]u Mh81ZVMhp0ZVuuuuu֍MAuE;;t~ % PLYuEu܉]uԉ]u؉]֋MEPju]+;}PYEPREf8.Yt h 3ZVMFEPMeh3ZVM-MEPju5+;}PBY9<\V}t.SEPh2ZV<ZVPh2ZV5<\VHZV;u@\Vff=]tJf;uA9<\Vt.SEPhp2ZV<ZVPhp2ZV5<\VHZV;u@\VhW/YGGfu֋MEPEԃP].;}PYGf8\f]uEP3YEPM\WMPEPYEPM=MEPju*;}P'Yhd2ZVMh`2ZVuYYt#EPYh3ZVM迧EPMޕh81ZVM覧MEPŕMhP2ZV舧5ZVMhH2ZVuuuu,MAE)3;tVSZVVPZV39]9<\VSEPhZVV<ZV=HZVPV5<\Vׅu@\V9<\VtrSEPj\VVu* P<ZVPjVu P5<\Vׅu@\V9<\Vt'SEPTZVV<ZVPV5<\Vׅu@\VME_^d [ø0r\VHSV3We]]؍EPjjjh~u EuU= uuZV3;}P=YuMEPEYu̍MW@EPMEjE39]t uZV;sEpf9uf"FۍEP9<\V=<ZVY3SEP4ZVVPV5<\V5HZV;u@\V9<\Vj M@j M܉E@ESEPuPu5<\V;u@\V9<\VSEPhTZVPhTZV5<\V;u@\V9<\VSEPh4ZVPh4ZV5<\V;u@\V9<\Vt\ESMQPEPu5<\V;u@\V9<\Vt.SEPhTZVPhTZV5<\V;u@\V5HZVh/ZVMEEf]]9]E]u] uZVEȋE9E=EPEPur :u h@蚾Y9]tuZV;vuMF>j,ME;9<\VEt~SEPh\4ZVPh\4ZV5<\V;u@\V9<\VtPSEPuPu5<\V;u@\V9<\Vt&SEPhTZVPhTZV5<\V;u@\V}u hսYuEPM?0MZ@ME:8]tEPM!EPMME:uMMEPu5ZV]uuu֍Mo:uu֋EM_^d [ËE@EDZVøBr\V|SVW3ۉeEPS]]؉]]܉]ZVh@ju ]u EZV5HZV=<ZVEȉ]ԉ]ЋE9E9<\Vt&SEPhTZVPhTZV5<\V;u@\VEPEPu . :u h@VY9<\Vt~SEPh5ZVPh5ZV5<\V;u@\V9<\VtPSEPuPu5<\V;u@\V9<\Vt&SEPhZVPhZV5<\V;u@\VEURhju]SP]QD;ÉE9<\VSEPhhZVPhhZV5<\V;u@\V9<\VtpSEPjh\Vu PPjh\Vu P5<\V;u@\V9<\Vt&SEPhTZVPhTZV5<\V;u@\VuYE؉E]EPEPu :u@PEźYhp0ZVu YY}h5ZVuYY9<\VSEPhp5ZVPhp5ZV5<\V;u@\V9<\VtpSEPj h\Vu PPj h\Vu P5<\V;u@\V9<\Vt&SEPhTZVPhTZV5<\V;u@\VEM@8,ZV0,ZVSuQR,=Et=Wt]9<\VSEPhhZVPhhZV5<\V;u@\V9<\VtpSEPjh\Vu PPjh\Vu P5<\V;u@\V9<\Vt&SEPhTZVPhTZV5<\V;u@\VuMIE8,ZVHttHtt hɸY}u<9]tuZVw EEPuu ;}PY9]u3 uZVDE̋EjSu"Eă EEĉEuЋEu8,ZV4,ZVj0,ZVuu7 ;ÉE}P蜷YE}}u"hp0ZVuAYYtPE۷Y9] 9<\Vt&SEPh5ZVPh5ZV5<\V;u@\VEuPQH;ÉE]9<\VSEPhhZVPhhZV5<\V;u@\V9<\VtsSEPjh\Vu PPjh\VuϿ P5<\V;u@\V9<\Vt)S|PhTZVPhTZV5<\V;u@\VuԶY9]| uSZVuZV;xAEъ3;tVSZVVPZVË5HZV=<ZV3ۋE܃M;t PQ]9]t=9<\Vt)S|Ph.ZVPh.ZV5<\Vօu@\VEuPQHME_^d [øtr\VTSV3We]܉]9<\V=<ZV]Et+SEP7ZVVPV5<\V5HZV;u@\V5HZVEPhAZVjShAZVZV;ÉE}79<\Vt&SEPh6ZVPh6ZV5<\V;u@\Vu\Y]ԉ]]؉]uE]ZVE̋E;E9<\Vt&SEPh0ZVPh0ZV5<\V;u@\VEPEPu :u h@Y9<\Vt~SEPht0ZVPht0ZV5<\V;u@\V9<\VtPSEPuPu5<\V;u@\V9<\Vt&SEPhZVPhZV5<\V;u@\VEPMfhp0ZVuYYt$EPEPu :uh@Y9<\Vt~SEPhT.ZVPhT.ZV5<\V;u@\V9<\VtPSEPuPu5<\V;u@\V9<\Vt&SEPhZVPhZV5<\V;u@\VEMQhju3QPRD=;t PbY9<\Vt&SEPh6ZVPh6ZV5<\V;u@\VEPM訆hp0ZVMp]}s>E@MQ8,ZV4,ZVS0,ZVuuD;}P_YE9<\Vt&SEPh.ZVPh.ZV5<\V;u@\VEu܋PQH;}PY]G9<\Vt&SEPhT6ZVPhT6ZV5<\V;u@\VEPMЅhp0ZVM蘗hH2ZVM苗M EP襅M hH2ZVmM EP茅9<\Vt&SEPh6ZVPh6ZV5<\V;u@\VEPQPu]ZVuZVuZVuZV8MAEƅ3;tVSZVVPZVË5HZV=<ZV39]܉]t=9<\Vt&SEPh.ZVPh.ZV5<\V;u@\VEu܋PQHE9]9<\VSEPhhZVPhhZV5<\V;u@\V9<\VtpSEPjh\Vu~ PPjh\Vuf P5<\V;u@\V9<\Vt&SEPhTZVPhTZV5<\V;u@\VEM;t ]PQME_^d [ør\V SVWeE3PS]]ZVSShZV̠\V;vSh7ZVhZVSZVhp7ZVu#9<\V=<ZVYYt+SEPZVVPV5<\V5HZV;u@\V5HZVjSZV;ÉE9<\VSEPhhZVPhhZV5<\V;u@\V9<\VSEPjh\Vu PPjh\Vu P5<\V;u@\V9<\VtTSEPhTZVPhTZV5<\V;u@\V9<\Vt&SEPhZVPhZV5<\V;u@\VSSZV;ÉEEEԉ]؉]9<\VEt&SEPh7ZVPh7ZV5<\V;u@\VEPhAZVjShAZVZV;ÉE}79<\Vt&SEPh6ZVPh6ZV5<\V;u@\Vu$Y]EPhH7ZVME;}P茭Yuu;YY}PtYuu;YY}P\Y9<\Vt&SEPh6ZVPh6ZV5<\V;u@\VEPQP9<\Vt6SEPh8ZVPh8ZV5<\V;u@\V<\V;tPTZVZVuZVE;Et ]PQMՁ3M܋AEI3;tVSZVVP}ZVË5HZV=<ZV3ۋEM;t PQ]9<\VSEPhhZVPhhZV5<\Vօu@\V9<\VSEPjh\Vu7 PPjh\Vu P5<\Vօu@\V9<\Vt6SEPhTZVPhTZV5<\Vօu@\V<\V;tPTZVZVE%M_^d [r\V螻$SVWeE3PS]]ZVSShZV̠\V;vShx8ZVhZVSZVh 8ZVul9<\V=<ZVYYt+SEPZVVPV5<\V5HZV;u@\V5HZVjSZV;ÉE9<\VSEPhhZVPhhZV5<\V;u@\V9<\VSEPjh\Vu诳 PPjh\Vu藳 P5<\V;u@\V9<\VtTSEPhTZVPhTZV5<\V;u@\V9<\Vt&SEPhZVPhZV5<\V;u@\VSSZV;ÉEhEEЉ]ԉ]EPhH7ZVME ;}PƩY]9<\VEt&SEPh7ZVPh7ZV5<\V;u@\VEPhAZVjShAZVZVEPu]u ;}PZY9<\Vt&SEPh7ZVPh7ZV5<\V;u@\VEMHPM{9<\VESEPh7ZVPh7ZV5<\V;u@\V9<\VtTESMQPEPu5<\V;u@\V9<\Vt&SEPhZVPhZV5<\V;u@\Vuu;YY}PpY9<\Vt&SEPh6ZVPh6ZV5<\V;u@\VEPQP9<\Vt6SEPh8ZVPh8ZV5<\V;u@\V<\V;tPTZVZVu5ZV֋E;Et ]PQu֍M|3M؋AEV|3;tVSZVVPp[VË5HZV=<ZV3ۋEM;t PQ]9<\VSEPhhZVPhhZV5<\Vօu@\V9<\VSEPjh\VuD PPjh\Vu, P5<\Vօu@\V9<\Vt6SEPhTZVPhTZV5<\Vօu@\V<\V;tPTZVZVE%M_^d [r\V諶SVWeE3PS]]ZVSShZV̠\V;vSh9ZVhZVSZVhP9ZVuy9<\V=<ZVYYt+SEPZVVPV5<\V5HZV;u@\V5HZVjSZV;ÉE9<\VSEPhhZVPhhZV5<\V;u@\V9<\VSEPjh\Vu輮 PPjh\Vu褮 P5<\V;u@\V9<\VtTSEPhTZVPhTZV5<\V;u@\V9<\Vt&SEPhZVPhZV5<\V;u@\VSSZV;ÉEJEE؉]܍M"h09ZVEh4-ZVPE+ ]EPhZVuME>;}P认YuMh8ZV ;}P蓤Y]EPuE;YY}PsYuMh8ZV ;}PXY9<\Vt6SEPh8ZVPh8ZV5<\Vօu@\V<\V;tPTZVZVu5ZVu֍M!M y3MAEx3;tVSZVVPE[VË5HZV=<ZV3ۋEM;t PQ]9<\VSEPhhZVPhhZV5<\Vօu@\V9<\VSEPjh\Vuo PPjh\VuW P5<\Vօu@\V9<\Vt6SEPhTZVPhTZV5<\Vօu@\V<\V;tPTZVZVE%M_^d [VtP%D$^r\V轲 eeSVW}eh@jW7w MAEwtVjZVVP[V39]9<\V5<ZVSEPhZVWPW5<\V=HZVׅu@\V9<\VtlSEPj\VSu PPjSu P5<\Vׅu!@\V=<\Vt$jEPTZVSPS5<\Vׅu!@\VME_^d [s\V荱S39<\VVW=<ZVeM]](SEP;ZVVPV5<\V5HZV;u@\V9<\VtOSEPuPu5<\V;u@\V9<\Vt%SEPTZVSPS5<\Vօu!@\V3h@ju uuE ;tf9u hWYE99<\Vt%SEP$ZVSPS5<\Vօu!@\V3ۋE0-MPE9u<9<\Vt%SEP#ZVSPS5<\Vօu!@\V3۸)PE耠Y9<\V]t%SEPX;ZVSPS5<\Vօu!@\V3ۋEMQuP萡;t~ % PE!Y9<\Vt%SEP:ZVSPS5<\Vօu!@\V3Su:;t~ % PEџY]ME7tPu=u%9]tu蠠u蘠5HZVM;~ % ;}PtYuuuU ;ÉE}PY9]tuEtM܋AEdstVjZVVPa [VË5HZV=<ZV39]9<\VSEPhZVSPS5<\Vօu!@\V=<\VtmjEPj\VSub PPjSuN P5<\Vօu!@\V=<\Vt$jEPTZVSPS5<\Vօu!@\VME_^d [ s\VES3;VWeM]]tf9uWPEY9<\V=<ZVSEPZVVPV5<\V5HZV;u@\V5HZVu ue;ÉE]3ZVu#jZVE=<\VjEP=ZVSPS5<\V3;u @\V9 <\VtqQEPj \VSu Z PPj Su F P5<\V3;u @\V9 <\Vt-QEPhTZVPhTZV5<\Vօu !@\V\VEPE0u uq~ % PEY:MAE9ktVjZVVP[VË5HZV=<ZV\V39E9<\VPE PhhZVPhhZV5<\Vօu!@\V=<\VthjE PjSu4 PPjSu P5<\Vօu!@\V=<\Vt$jE PTZVSPS5<\Vօu!@\VME_^d [ .s\V軥S39<\VVW=<ZVe]]SEP>ZVVPV5<\V5HZV;u@\V9<\VttSEPj \VSu V PPj Su B P5<\V3;u @\V9 <\Vt+QEPTZVSPS5<\Vօu!@\V5HZVu u讖M;QM%Y?MAEBitVjZVVP[VÃ}5HZV=<ZV=<\VjE PhZVSPS5<\Vօu!@\V=<\VtmjE Pj\VSu? PPjSu+ P5<\Vօu!@\V=<\Vt$jE PTZVSPS5<\Vօu!@\VME_^d [ 8s\VƣSVWeh@ju3ۉu]]>h MQMQuEPf]L;=t;~ % PE貓Y9<\V=<ZVt+SEP?ZVVPV5<\V5HZV;u@\V5HZV] 3ZVu#jZVu:9<\Vt#PEP?ZVSPS5<\Vօu!@\VPEYE=<\Vt}jEP(?ZVSPS5<\Vօu!@\V=<\VtP3SEPuPu5<\V;u@\V9<\Vt$jEPZVSPS5<\Vօu!@\VEMQM 1uPt~ % PE`Y3ۋM 9uQhGZVdE5HZV=<ZVߋM؋AE\ftVjZVVPi[VË5HZV=<ZV39]9<\VSEPhZVSPS5<\Vօu!@\V=<\VtmjEPj\VSuZ PPjSuF P5<\Vօu!@\V=<\Vt$jEPTZVSPS5<\Vօu!@\VME_^d [Bs\VSVWeh@ju 3ۉM]][e=<ZV 9<\VSEP(@ZVVPV5<\V5HZV;u@\V9<\VtOSEPuPu5<\V;u@\V9<\Vt%SEPTZVSPS5<\Vօu!@\V3ۋEMQu uP;~ % PEOY?5HZVËM܋AEddtVjZVVPa[VË5HZV=<ZV39]9<\VSEPhZVSPS5<\Vօu!@\V=<\VtmjEPj\VSub PPjSuN P5<\Vօu!@\V=<\Vt$jEPTZVSPS5<\Vօu!@\VME_^d [Ls\VSVW}e@V3jWM]]ac Vju Sc ;tf9u hWYE=<ZV9E9<\Vt+SEP$ZVVPV5<\V5HZV;u@\V5HZVE0MP\E9uE9<\Vt&SEPh#ZVPh#ZV5<\V;u@\V)PEQY5HZVE 9<\Vt~SEPhh@ZVPhh@ZV5<\V;u@\V9<\VtPSEPuPu5<\V;u@\V9<\Vt&SEPhZVPhZV5<\V;u@\Vu EuP;t~ % PE蓍Y9<\Vt&SEPh)ZVPh)ZV5<\V;u@\VE S0詎;tP~ % PE@Y8M܋AE]a3;tVSZVVPi[VË5HZV=<ZV39]9<\VSEPhhZVPhhZV5<\Vօu@\V9<\VtpSEPjh\VuZ PPjh\VuB P5<\Vօu@\V9<\Vt&SEPhTZVPhTZV5<\Vօu@\VME_^d [as\Vܛ\VSV3EW@\VVV@ZVWu̠\V;t}P踛YSPW̠\VvQN^;t(=ZVS;vSf|C\th@1ZVpu pǑYjuՌtWu ]95@\VtGVSjVV@Wؠ\V<\VPh\Vu/5@\V5<\VZVM_^d M[VÍPZ]9t:ZV;v*ZVf|A\th@1ZVou oVSjVVWؠ\V<\Vu 35@\V<\V;IVQjQPƅƅHZV5@\Vs\V躙,SV3WeM؉uu܉uMNuԉuuME3\E9uuZVuEh9ZVPuЃ M ^MPVB}PYuM]PV躊=t ~# PUYM؍EPju}PĈYu,t ~# P YeM؍EPuE E}P膈Yu3;t%=ZVV;vVf|F/t hZVM'nM EPغ9]tuZV;vu*YM Pm9<\V=<ZV.SEPAZVVPV5<\V5HZVօu@\V9<\V]jEPSPS5<\Vօu!@\V=<\VjEPTZVSPS5<\Vօu!@\V=<\VjEPh\AZVPh\AZV5<\Vօu!@\V=<\VpjEPuPu5<\Vօu!@\V=<\V@jEPSPS5<\Vօu!@\V=<\VjEPhAZVPhAZV5<\Vօu!@\V=<\VjEPuPu5<\Vօu!@\V=<\VjEPSPS5<\Vօu!@\V=<\VjEPh@ZVPh@ZV5<\Vօu!@\V=<\VPjEPuPu5<\Vօu!@\V=<\V jEPSPS5<\Vօu!@\V=<\VjEPh@ZVPh@ZV5<\Vօu!@\V=<\VE jM QPEPu5<\Vօu!@\V=<\VjEPSPS5<\Vօm!@\Vbu视t ~# P蛅YuEhH:ZVP uЃ MYMPV&}